Service

Optimierung des Druckergebnisses – warum Farbe nicht gleich Farbe ist


optimierung_des_druckergebnisses_abbildung_1_titelbild.jpg__498x280_q80_crop-,.jpg
(Foto: pixabay.com © geralt (CC0 Public Domain))

1. Das Problem mit dem unbefriedigenden Ausdruck

Es ist das alte Dilemma für Hobbyfotografen. Die Schnappschüsse vom letzten Sommerurlaub oder der letzten Familienfeier wurden mit großer Sorgfalt und viel Liebe für Bild- und Farbkompositionen aufgenommen, die technischen Möglichkeiten der neuesten digitalen Spiegelreflexkamera dabei bis zum Äußersten ausgereizt. Die Vorschau am heimischen PC bestätigt die Qualität der getanen Arbeit noch einmal und die besten Bilder sind es in jedem Fall wert, als Ausdruck der Öffentlichkeit zugänglich gemacht oder vielleicht in einem der beliebten Fotobücher verewigt zu werden.

Doch nach dem Druck stellt sich Ernüchterung ein: Die Farben entsprechen nicht den Originaltönen, Kontraste fehlen oder sind zu stark, die Motive wirken unscharf. Der ganze Aufwand scheint umsonst gewesen zu sein, weil die Bilder in ihrer physischen Form weder ihren digitalen Originalen noch den Ansprüchen des Fotografen gerecht werden. Der Frust ist groß, aber möglicherweise doch vermeidbar. Denn abgesehen von einer Reihe verschiedener Faktoren, die das Druckergebnis beeinflussen können, liegt die Diskrepanz zwischen Datei und Druck hauptsächlich an unzureichendem Farbmanagement. Dabei kann genau das helfen, die gewünschten Ergebnisse zu erzielen.

2. Die Welt der Farbmodelle

Das Thema Farbe ist aus vielerlei Gründen kein einfaches, das zeigen schon die verschiedenen Wortbedeutungen: Farbe ist eine individuell unterschiedliche visuelle Wahrnehmung, die durch Licht hervorgerufen wird. Der Begriff Farbe wird im Sprachgebrauch aber auch synonym für das Buntsein an sich verwendet. Er steht darüber hinaus für färbende Substanzen beziehungsweise Farbstoffe und bezeichnet nicht zuletzt Spielkarten mit dem gleichen Zeichen.

a. Sprachliche Grenzen: Von der Benennung zum System

Die Schwierigkeiten des sprachlichen Umgangs mit Farbe gehen sogar noch weiter, wenn zum Beispiel die Fülle an verschiedenen Tönen und Nuancen benannt werden sollen. Es ist nämlich nicht ohne weiteres möglich, konkrete Zahlen für die menschliche Farbwahrnehmung aufzustellen – denn die ist schon von den physiologischen Voraussetzungen jedes einzelnen Menschen abhängig. Die Angaben dahingehend sind somit in gewisser Weise spekulativ und schwanken dementsprechend zwischen 150 Spektralfarben und rund 20 Millionen Farben.

optimierung_des_druckergebnisses_abbildung_2.jpg__500x500_q80.jpg
(Foto: fotolia.com © natros)

Aber selbst wenn die Zahl auf einen Mittelwert im sechsstelligen Bereich beschränkt wird, ergibt sich für den alltäglichen Umgang immer noch das Problem der sprachlichen Differenzierung so vieler Farbtöne. Grundsätzlich gibt es für deren Benennung zwei Möglichkeiten: direkte oder indirekte Farbbezeichnungen. Erstere benennen lediglich eine unmittelbar empfundene Grundfarbe, etwa Rot, Blau oder Gelb, ohne eine nähere Bestimmung einer spezifischen Tönung. Bei indirekten Bezeichnungen werden Vergleiche mit der Umwelt oder Hinweise auf den Herstellungsprozess für eine genauere Bestimmung verwendet, zum Beispiel Kanariengelb oder Feuerrot.

Nach diesem Schema der indirekten Benennung lassen sich in manch einer Sammlung von Farbnamen zwischen Rot und Silber über 3.000 unterschiedliche Bezeichnungen finden. Darüber hinaus gibt es sogar die Möglichkeit, die Findung neuer Farbnamen online aktiv mitzugestalten. Solche Versuche oder Sammlungen zeigen dennoch auf, dass nicht nur die Farbwahrnehmung, sondern auch deren Bezeichnung eine recht subjektive Angelegenheit ist. Zu den persönlichen kommen regionale, kulturelle und zeitlich bedingte Prägungen, die Einfluss auf die Farbnamen nehmen. Die daraus resultierenden Farbnamen wie „Braunschweigerschwarz“ oder „Falunerrot“ muten daher regelrecht exotisch an. Eine Möglichkeit, die Farben gemäß bestimmten Standards zu organisieren, sind demgegenüber die Farbsysteme.

b. Frühere Versuche: Farbsysteme von Aristoteles bis Küppers

Bereits im vierten Jahrhundert vor Christus brachte es Aristoteles (384 bis 322 vor Christus) fertig, ein Farbsystem zu erschaffen, dessen Wirkung noch bis in die Frühe Neuzeit fortbestand. Er erweiterte das ältere System des Pythagoras, das basierend auf der Vier-Elemente-Lehre von vier elementaren Farben ausgegangen war, um drei weitere Farben und ordnete diese in einer Reihe von hell nach dunkel an.

optimierung_des_druckergebnisses_abbildung_3.jpg__222x1000_q80.jpg
(Foto: commons.wikimedia.org (Public Domain Mark 1.0))

Erst seit dem 17. Jahrhundert wurde die Systematisierung in Form einer Reihe aufgebrochen. So entwickelte der finnische Astronom Aron Sigfrid Forsius (1569 bis 1624) in einer seiner Arbeiten zur Physik einen Farbkreis aus insgesamt 16 Farben, der sich schon als dreidimensionale Farbkugel interpretieren lässt. Eines der bekanntesten kreisförmigen Farbsysteme schuf etwa 100 Jahre später Isaac Newton (1643 bis 1727) im Rahmen seiner Forschungen zu den Spektralfarben, die seiner Farbordnung zugrunde liegen.

optimierung_des_druckergebnisses_abbildung_4.jpg__222x1000_q80.jpg
(Foto: commons.wikimedia.org (Public Domain Mark 1.0))

Goethe (1749 bis 1821) beschäftigte sich in seiner Farbenlehre zwar (kritisch) mit der physikalisch-wissenschaftlichen Herangehensweise. Dennoch gelangte er zu einem grundlegend anderen Farbverständnis, bei dem den sinnlich-sittlichen Wirkungen der verschiedenen Farben größere Bedeutung zukommt. Nach einem ähnlichen Prinzip ist die Farbkugel von Philipp Otto Runge (1777 bis 1810) entstanden. Grundlage seiner Arbeiten war das Bemühen um eine Veranschaulichung der Harmonien zwischen den Farben, für deren Ordnung ein idealer Farbkörper dienen sollte.

Im 19. Jahrhundert stand die Auseinandersetzung zunehmend unter dem Eindruck der fortschreitenden Industrialisierung und des technologischen Fortschritts. So fand James Clerk Maxwell (1831 bis 1879) unter anderem die Möglichkeit, Farbmischungen mittels Gleichungen zu erfassen, die er auf ein Dreieck übertrug. Anders ging wiederum der amerikanische Künstler Albert Henry Munsell (1858 bis 1918) an die Thematik der Farbordnung heran: Sein Farbsystem berücksichtigte die menschliche Wahrnehmung, durch die mathematisch gleichmäßig durchgeführte Farbveränderungen vom Menschen keineswegs als gleichmäßig empfunden werden. Basierend auf einem dreidimensionalen Modell bestehend aus den Achsen Farbton („Hue“), Farbwert („Value“) und Sättigung („Chroma“) entstand so ein ungleichmäßig geformtes Gebilde, bei dem die Abstände der einzelnen Farben als gleich empfunden werden.

Munsell ging bei seinem System von fünf Hauptfarben und fünf Nebenfarben aus. Im Gegensatz dazu entwickelte Harald Küppers sein Farbsystem aus nur acht Grundfarben, sechs bunten und zwei unbunten. Die bunten Grundfarben werden zu einem Sechseck zusammengefasst, das zusammen mit der Unbuntachse zwischen Weiß und Schwarz in ein dreidimensionales Rhomboeder gefasst wird. In diesem Farbraum können die Farben quantitativ – also nicht qualitativ, das heißt nach Munsells empfindungsmäßiger Gleichabständigkeit – mit Kennzahlen lokalisiert werden.

c. Das additive Modell: RGB

Das RGB-Farbmodell basiert auf den primären Grundfarben Rot, Grün und Blau. Aus diesen können alle übrigen Farben des RGB-Modells gemischt werden. Als Ausgangsfarbe dient Schwarz, die Mischung der drei Basisfarben zu gleichen Teilen ergibt hingegen Weiß. Die neuen Farben, die bei der additiven Mischung der Grundfarben entstehen, sind im Übrigen immer heller als die ursprünglichen Farben. Das dahinterstehende Prinzip dieses Modells ähnelt der Funktionsweise des menschlichen Auges, dessen unterschiedliche Zapfen ebenfalls die Bereiche Rot, Grün und Blau abdecken.

Verwendung findet das RGB-Modell bei selbstleuchtenden Systemen, bei denen die additive Lichtmischung genutzt wird. Bei Bildwiedergabegeräten wie Fernseher oder Computermonitore bestehen die einzelnen Bildpunkte aus drei Lämpchen in den Basisfarben. Schwarze Bildschirmflächen entstehen also durch das Ausschalten aller Lichtpunkte, das gleichzeitige Leuchten aller drei Lämpchen produziert einen weißen Bildpunkt. Alle übrigen Farbtöne können additiv gemischt werden.

optimierung_des_druckergebnisses_abbildung_6.jpg__500x500_q80.jpg
(Foto: fotolia.com © MC Rendered Artwork)

d. Das subtraktive Modell: CMYK

Das Prinzip der Farbenentstehung des CMYK-Modells stellt das Gegenstück zu RGB dar. Denn natürlicherweise entstehen Farben nicht durch das Mischen verschiedenfarbiger Lichtquellen, sondern vielmehr durch die unterschiedlich starke Absorption und Reflexion von weißem Licht auf einer stofflichen Oberfläche. Das Licht durchläuft gewissermaßen farbige Filter, die nur bestimmte Wellenlängen reflektieren – aus dem Licht werden somit bestimmte Farben entfernt.

Das subtraktive CMYK-Modell geht darüber hinaus von anderen Grundfarben aus. Türkis (Cyan), Magenta und Gelb (Yellow) entstehen dadurch, dass bei der Farbmischung nur eine der drei additiven Grundfarben absorbiert wird. Dazu ist das Verhältnis von Schwarz und Weiß im Vergleich zum RGB-Modell umgekehrt: Weiß ist hier die Ausgangsfarbe, die Mischung aller Farben ergibt hingegen Schwarz. Im modernen Vierfarbdruck, wo CMYK hauptsächlich Verwendung findet, muss das Schwarz (BlacK oder Key) allerdings zusätzlich hinzugefügt werden, weil es durch die Mischung der Farben nicht erreicht werden kann.

optimierung_des_druckergebnisses_grafik_1.jpeg__500x500_q80.jpg

e. Die Unterschiede von RGB und CMYK

3. Vom Modell zum Farbraum

a. Das Verhältnis von Farbmodell zu Farbraum

Tatsächlich bilden die Farbmodelle nur die Grundlage, denn die Farben werden innerhalb des Farbraums festgelegt. Ausgehend vom zugrundeliegenden Modell ergibt sich der dazugehörige Farbraum aus der jeweiligen numerischen Methode zur Beschreibung der Farben. Das Farbmodell selbst ist dabei zunächst abstrakt und umfasst alle Farben, die mit einer bestimmten farbgebenden Methode dargestellt werden könnten.

Die Farbräume sind meist dreidimensionale Darstellungen der Farbmodelle für den praktischen Gebrauch. Das Ziel bei der Gestaltung eines Farbraums ist immer die Übereinstimmung mit der menschlichen Farbwahrnehmung und zwar innerhalb der Grenzen des dazugehörigen Modells. Im Idealfall füllt daher der Farbraum das gesamte Farbmodell aus, normalerweise ist er aber nur eine Variante des Modells mit einem bestimmten (begrenzten) Umfang von Farben.

Die praktische Umsetzung, beispielsweise im Druck, führt allerdings oftmals zu Verlusten. Trotz eines klar definierten Zahlenwerts (Farbort) sind die verfügbaren Farbmittel mitunter nicht ausreichend für eine exakte Wiedergabe eines bestimmten Farbtons. Auch auf dem Übertragungsweg zwischen verschiedenen Geräten mit eventuell sogar unterschiedlichen Farbmodellen gibt es Verluste und Verfälschungen.

optimierung_des_druckergebnisses_grafik_3.jpeg__500x500_q80.jpg

b. Arbeitsfarbräume: Was ist das?

Ein Arbeitsfarbraum ist ein Farbraum, der ganz konkret bei der Bearbeitung von digitalen Bilddateien genutzt beziehungsweise vorgegeben wird. Bei Digitalkameras etwa bestimmt ein solcher Farbraum die Zahl der Farben, die im Höchstfall aufgenommen werden können. Neben den geräteabhängigen Farbräumen, über die beispielsweise Drucker verfügen, gibt es medienneutrale, geräteunabhängige Farbräume, die als Referenzgröße für verschiedene Farbräume innerhalb desselben Bildbearbeitungsprozesses dienen.

Für den Druck gilt, dass der Arbeitsfarbraum nach Möglichkeit alle Farben umfassen sollte, die letztendlich auch produziert werden könnten. Auf diese Weise können Farbverluste im Verlauf des Prozesses wenigstens verringert werden. Beim Transfer zwischen verschiedenen Geräten mit verschiedenen Farbräumen können durch die notwendigen Umwandlungen ebenfalls Farbabweichungen auftreten.

c. Die gängigsten Vertreter

Die Größe der verwendeten Arbeitsfarbräume ist immer auch abhängig von den Eigenschaften der genutzten Geräte. Zwischen einer modernen Digitalkamera, einem Monitor und einem Drucker kann die Zahl der darstellbaren Farben stark variieren. Je nach Anwendungsgebiet machen unterschiedliche Farbraumgrößen dennoch Sinn.

i. sRGB
Der sRGB-Farbraum wurde 1996 gemeinsam von Microsoft und Hewlett-Packard entwickelt. Er ist zugleich aber auch der kleinste und dennoch verbreitetste Farbraum. Das liegt zum einen daran, dass er im Amateurbereich der Digitalfotografie etabliert ist. Zum anderen kann sRGB von gängigen Monitoren vollständig und ohne Farbverluste dargestellt werden, weswegen er auch bei Internetpublikationen hauptsächlich verwendet wird.

ii. AdobeRGB
Im Jahr 1998 entwickelte die Adobe einen Farbraum, der mindestens alle Farben des im Druck verwendeten CMYK-Farbraums beinhalten sollte. Der AdobeRGB ist daher sehr groß ausgefallen, mit einem deutlich größeren Umfang grüner Farbtöne. Somit sind sehr viel mehr natürlich vorkommende Grüntöne darstellbar. Praktisch ist zudem, dass die druckbaren Farben auch an einem Bildschirm, der AdobeRGB unterstützt, korrekt angezeigt und bearbeitet werden können.

iii. eciRGB
Der eciRGB-Farbraum geht zurück auf das Bemühen der European Color Initiative (ECI), einen Farbraum für die medienneutrale, professionelle Bildbearbeitung zu schaffen. Dazu wurde er an den Großteil aller Druckverfahren angepasst und eignet sich somit für die Weiterverarbeitung von Bildern für die Druckvorstufe.
Das ursprüngliche eciRGB 1.0 aus dem Jahre 1999 hat mittlerweile einen Nachfolger erhalten. Dessen Farbumfang ist identisch, wurde aber dem menschlichen Helligkeitsempfinden besser angepasst. Die Ausrichtung auf die Grafikindustrie bringt es jedoch mit sich, dass es beispielsweise kaum Kameras gibt, die irgendeine Version von eciRGB unterstützen.

d. Die Unterschiede der Arbeitsfarbräume

optimierung_des_druckergebnisses_grafik_2.jpeg__500x500_q80.jpg

4. Das Farbmanagement

Von der digitalen Aufnahme eines Motivs bis zu dessen Ausdruck kommen also mitunter durch die Verwendung unterschiedlicher, geräteabhängiger Farbräume ebenso unterschiedliche Farbbeschreibungen zum Einsatz. Das ist in vielen Fällen kein allzu schwerwiegender Nachteil. Dennoch sind gerade beim Druck Abweichungen der Farbdarstellung umso ärgerlicher.

a. Sinn und Zweck des Farbmanagements

Das richtige Farbmanagement soll, in einem Satz zusammengefasst, für die bestmögliche Farbtreue zwischen der Ein- und Ausgabe eines Bildes sorgen. Das bedeutet, dass die Ähnlichkeit zwischen der Vorlage, die mit einem beliebigen Eingabegerät aufgenommen wurde, und deren Darstellung an einem beliebigen Ausgabegerät möglichst groß sein sollte.

optimierung_des_druckergebnisses_grafik_4.jpeg__250x500_q80.jpg

Mit Hilfe des Farbmanagements haben Hobbyfotografen wie auch Profis die Möglichkeit, während des gesamten Bildbearbeitungsprozesses über eine verlässliche Farbdarstellung zu verfügen. Auf diese Weise können also unliebsame Überraschungen hinsichtlich der Qualität des Endprodukts schon im Vorfeld vermieden werden. Abhängig von den Ansprüchen an die gelieferten Ergebnisse kann das Thema Farbmanagement allerdings auch vernachlässigt werden. Die Verfahrensweise ist recht komplex und kann das Resultat bei fehlerhafter Anwendung durchaus negativ beeinflussen – Konvertierungen von einem RGB-Farbraum in einen CMYK-Farbraum lassen sich beispielsweise nicht wieder umkehren.

b. Der Einfluss von Farbprofilen

Bei der Bildbearbeitung sind zwischen dem Ablichten und dem Druck mindestens zwei Farbprofile im Einsatz, nämlich ein Eingangsprofil und ein Ziel- beziehungsweise Ausgabeprofil. Solche Farbprofile entsprechen einer Zuordnungstabelle, mit der die Farben innerhalb eines Farbraums anhand von Zahlenwerten exakt festgelegt werden.

Die Geräteprofile geben dabei jeweils an, welche Farben eine Kamera oder ein Scanner überhaupt erfassen kann. Das kann nicht nur von Hersteller zu Hersteller variieren, sondern aufgrund minimaler technischer Abweichungen sogar bei Kameras desselben Typs. Insofern entsprechen die Geräteprofile in gewisser Weise den individuellen Unterschieden der menschlichen Farbwahrnehmung.

Bei einer deutlich unterschiedlichen Größe zweier Farbräume kann es allerdings passieren, dass ursprüngliche Farbdifferenzierungen nicht mehr wiedergegeben werden können. Denn Farben, die außerhalb eines vorgegebenen Farbraums liegen, erhalten automatisch den höchstmöglichen Farbwert. Dabei ist die Entfernung von den Grenzen des Farbraums unerheblich – so erhalten zum Beispiel alle Bildpunkte mit nicht darstellbaren Rottönen den größtmöglichen Wert und erscheinen als eine einzige Farbe. Um die Farbunterschiede wieder sichtbar zu machen, wird durch eine Konvertierung die Sättigung der Farben solange reduziert, bis sie auch im Ausgabefarbraum darstellbar sind.

c. Das ICC-Standardprofil

Um die Farbähnlichkeit zu erhalten, werden die verwendeten Farbräume genau definiert. An dieser Stelle greift die schon angesprochene Zuordnungstabelle, bei der die Farben den dazugehörigen Zahlenwerten gegenüberstehen. Diese Zuordnung gilt wohlgemerkt für die Gerätefarbräume: Die von Bilddateien genutzten Arbeitsfarbräume wie sRGB oder AdobeRGB sind geräteunabhängig definiert.

Seit dem Jahr 1993 bemüht sich das International Color Consortium (ICC), ein Zusammenschluss verschiedener Unternehmen, um eine Vereinheitlichung des Farbmanagements. Zu diesem Zweck wurde ein Farbprofil entwickelt, das unabhängig von Hersteller oder Plattform als Standard dienen kann. Das ICC-Profil hilft also dabei, die Farbmanagementsysteme verschiedener Geräte für eine möglichst große Farbtreue aufeinander abzustimmen.

optimierung_des_druckergebnisses_abbildung_9.jpg__500x500_q80.jpg
(Foto: fotolia.com © Dron)

Damit das ICC-basierte Farbmanagement aber wirklich greift, sollten alle am Bildbearbeitungsprozess beteiligten Geräte entsprechend profiliert werden. Das bedeutet nichts anderes, als dass die Farbdarstellung von Digitalkamera, Monitor, Scanner und Drucker gemessen wird. Die Ergebnisse der Geräte werden mit den idealen Werten eines Referenzfarbraums – zumeist des CIELab-Farbraums – abgeglichen.

Das gerätespezifische ICC-Profil besteht aus der Differenz zwischen den gemessenen und den Sollwerten. Zur Weiterverwendung wird das Profil als Datei gespeichert. Zusammen mit einem Farbmanagement-Modul – Apple, Microsoft und Adobe haben hier jeweils eigene Anwendungen entwickelt – kann eine möglichst verlustfreie Umrechnung zwischen verschiedenen Farbräumen durchgeführt werden.

5. Vom Bildschirm auf das Papier

Der finale Schritt der Bildbearbeitung ist natürlich der Ausdruck des aufgenommenen Bildes. Dazu wird vor allem im professionellen Offsetdruck das Vierfarbdruckverfahren angewendet.

a. Der moderne Vierfarbdruck im CMYK-Modus

optimierung_des_druckergebnisses_abbildung_10.png__250x1000_q80.png
(Foto: commons.wikimedia.org © Slippens (Public Domain))

Im subtraktiven CMYK-Farbmodell entstehen die Farben durch die unterschiedliche Filterung und Reflexion des Lichts. Im entsprechenden Druckverfahren werden die Bildvorlagen zunächst am Computer in die vier Grundfarben Cyan, Magenta, Yellow und Key zerlegt. Die Druckdateien werden anschließend in der Druckvorstufe einzeln aufgerastert – das heißt in kleine Bildpunkte gespalten – und auf separate Druckplatten belichtet. Die Platten tragen somit nur die jeweiligen Farbanteile des Gesamtbildes.

Im nächsten Schritt werden die Druckplatten in das jeweilige Druckwerk eingespannt. Beim Offsetdruck erfolgt der eigentliche Druck auf das Papier indirekt, denn zwischen der Platte und dem Papierbogen befindet sich ein mit Gummituch bespannter Zylinder. Die Farbe wird also von der Druckplatte auf das Gummituch und danach auf das Papier übertragen.

Die Druckplatten verfügen in diesem Verfahren über farbabweisende und farbaufnehmende Bereiche, basierend auf dem unterschiedlichen Verhalten verschiedener Substanzen bei Wasserkontakt. Die bildfreien Stellen reagieren nämlich hydrophil: Sie nehmen schon bei minimaler Befeuchtung eine ausreichende Menge Wasser auf, um sie farbabweisend zu machen. Umgekehrt verhält es sich mit den lipophilen Bereichen, die kein Wasser, dafür aber die Farbe aufnehmen. Um die Farbgebung der Vorlage zu erhalten, werden die Einzelfarben nacheinander auf den Bedruckstoff gebracht.

Da die drei bunten Farben zusammen kein reines Schwarz ergeben, wird es als vierte Farbe selbst aufgetragen. Dadurch erhält das Bild außerdem seine Tiefe. Die Möglichkeiten der Farbdarstellung sind im CMYK-Modus leider begrenzt, daher sind beispielsweise bei fest definierten Farben eines Corporate Designs zusätzliche Sonderfarben nötig.

b. Farbmanagement für den optimalen Fotodruck

Soll am Ende der Arbeitskette ein mehr als nur akzeptables Ergebnis entstehen, kann das richtige Farbmanagement beim Fotodruck in dieser Hinsicht Abhilfe schaffen. Denn Arbeitsfarbräume von Scannern und Digitalkameras sind, wie der AdobeRGB, so groß, dass die Farben im sehr viel kleineren CMYK-Farbraum des Druckers gar nicht vollständig dargestellt werden können. Dazu kommen mögliche Abweichungen bei der physischen Umsetzung, die sich aus der Beschaffenheit der verwendeten Farben und des Bedruckstoffs ergeben.

Das liegt unter anderem daran, dass die Grundfarben des CMYK eben keine reinen Farbtöne sind. Zudem werden die Farbpunkte beim Vierfarbdruck mit leichten Überschneidungen übereinander gedruckt – die Haftung von Farben auf anderen Farben ist allerdings weniger gut als auf dem Papier. Dieses wiederum kann durch seine Eigenfarbe – oftmals gelblich oder bläulich – zu einer weiteren Verfälschung der Farbtöne gegenüber den RGB-Farben führen.

optimierung_des_druckergebnisses_grafik_5.jpeg__500x500_q80.jpg

Damit das gedruckte Bild in seiner Farbigkeit der Vorlage entspricht, kann eine Auseinandersetzung mit dem Thema Farbmanagement durchaus lohnenswert sein. Wenn beim Druck nicht nur der eigene Drucker zu Hause benutzt wird, sollten Farbprofile der Anbieter genutzt werden, sofern diese zur Verfügung stehen. Damit können mittels eines „Soft Proofs“ die Farben des Ausdrucks schon am Bildschirm simuliert und die Qualität des Ergebnisses vorab eingeschätzt werden.

6. Schritt für Schritt zum besseren Ergebnis

Wer beim digitalen Fotografieren nicht nur auf ein paar schnelle Schnappschüsse aus ist, sondern sein Hobby mit einer gewissen Ernsthaftigkeit betreiben möchte, wird sich früher oder später sicherlich auch mit dem Farbmanagement auseinandersetzen.

Allerdings ist zu beachten, dass die Thematik des Farbmanagements recht schnell sehr komplex werden kann. Das liegt nicht zuletzt auch an der Unzahl technischer Fachbegriffe, mit denen Interessierte zunächst konfrontiert werden. Als Einstieg eignen sich daher Ratgeber wie Andreas Beitingers Farbmanagement für Hobbyfotografen, die Themenseiten von heise Foto oder die Ausführungen von Ulrike Häßler.

Hier lässt sich gleichermaßen ein guter Überblick über die Begrifflichkeiten und Zusammenhänge des Themenfeldes und dessen Komplexität gewinnen. In jedem Fall kann so ein Grundwissen erworben werden, das wiederum bei der Entscheidung hinsichtlich eines Farbmanagements für die heimische Fotosammlung helfen kann.